SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336320645|ref|YP_004600613.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336320645|ref|YP_004600613.1|
Domain Number 1 Region: 184-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-44
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 546-675
Classification Level Classification E-value
Superfamily TPR-like 0.0000133
Family BTAD-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336320645|ref|YP_004600613.1|
Sequence length 770
Comment serine/threonine protein kinase [[Cellvibrio] gilvus ATCC 13127]
Sequence
MTACTEPGCTGTYEDGYCNVCGAPQAPTAPAPVSPAAGPSATSLLGTGIAGGGGTARPTS
AAPGPDRDERSTRTGRTSSSRLATAALGSARTSAGGSRTTRRVGTSSTRLRGQRLGAGLT
AVPPVPVRDPLQVVMADPQVPERKRFCPQCGTPVGRERDGVPGRTQGFCPQCGTGFDFDP
RLVAGDVVGGQYEVVGCLAHGGLGWIYLARDQNVSGRWVVLKGLLNAGDADAYAAAIAER
QFLAEVEHPLIVEIYNFVMHDGAGYIVMEYVGGTSLKQMLTARRDANGGVNDPLPVDQAI
ALVLEVLPAFAYLHDVGLLYCDLKPDNVIQQGDAVKLIDLGGVRRIDDLQSAIFGTVGYQ
APEVAEVGPSVASDVYTVGRTLASLVLDFRGNTTTYVAALPPVAETPVFQTYDSFYRLLA
KACAPDPSDRFATVDELRNQLLGVLREVVAADRGPGNPALHSAASVLFEPPTTDGATAPL
RWDELPALRVDPGDPASGWLAGVSVSDPVRRIEALGAAPDDSVEVRLARARAGIEAGRSE
VVRTALAQVLDEDPWEWRAAWTDGLAQLAAGDALAARASFNAVYGQVPGELAPKLALAVS
CELSGEPEIAESLYVICARSDANYTAAAAFGLARIREARGDLDGALGALDLVTPTRSSFV
ASRLRRARLLAASDRGVAGLADALQGLDRLTIEPQERVDLRISVFEGALEAVRRGGVRPG
QRIADVPADEPALRDALEAAYRESAVLAPTRQERVALVDRANAVRRWTLW
Download sequence
Identical sequences F8A4D9
WP_013883564.1.66935 gi|336320645|ref|YP_004600613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]