SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336321172|ref|YP_004601140.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336321172|ref|YP_004601140.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-45
Family Ribonuclease PH domain 1-like 0.000000388
Further Details:      
 
Domain Number 2 Region: 326-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-43
Family Ribonuclease PH domain 1-like 0.000000384
Further Details:      
 
Domain Number 3 Region: 153-263
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-25
Family Ribonuclease PH domain 2-like 0.0000103
Further Details:      
 
Domain Number 4 Region: 479-578
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.86e-23
Family Ribonuclease PH domain 2-like 0.0000169
Further Details:      
 
Domain Number 5 Region: 581-693
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 270-350
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.18e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336321172|ref|YP_004601140.1|
Sequence length 746
Comment guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase [[Cellvibrio] gilvus ATCC 13127]
Sequence
MEGPEIQFAEAVIDNGRFGTRTVRFETGRLAKQAAGSAAAYLDGDTMLLSATTAGKHPKE
QFDFFPLTIDVEERQYAAGKIPGSFFRREGRPSTEAILACRLVDRPLRPLFVKGLRNEVQ
VVITVLAIHPDDAYDVLAINAASISTQLSGLPFSGPVGGVRIALVDGQWVAFPRYSERER
ATFDMVVAGRVVTAADGSSDVAIAMIEAEAPEKSWNLIQEGATAPTEEIVAAGLDAAKPF
IRVLVEAQAELAAKAAKETQVFPTFPDYQADAYDAVEAASAGPLGEALSIADKQTRENRL
DEIKAEVVAQLAEQFAGREKELSAAYRSVQKKLIRQRILTDGFRIDGRGLRDIRTLGAEV
EVLPRVHGSALFERGETQILGVTTLNMLRMEQQLDTLSPETRKRYMHNYNFPPYSTGETG
RVGSPKRREIGHGALAERALMPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLSLL
NAGVPLRAPVAGIAMGLVSDTVDGQTRYAALTDILGAEDAFGDMDFKVAGTREFVTAIQL
DTKLEGIPASVLAGALTQAKEARLAILDVIAEAIDVPDEMSPFAPRVITVKVPVDKIGEV
IGPKGKMINQIQEETGADISIEDDGTVYIGATDGPSAEAARAAINAIANPHMPEIGERFV
GTVVKTTTFGAFISLSPGKDGLLHISQIRKLVGGKRVENVEDVLAVGQKVQVEIGEIDPR
GKLSLHAVIDEAAEQAGADDAEKADA
Download sequence
Identical sequences F7ZZS9
gi|336321172|ref|YP_004601140.1| WP_013884090.1.66935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]