SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557685440|ref|YP_008788913.1| from Streptomyces rapamycinicus NRRL 5491

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557685440|ref|YP_008788913.1|
Domain Number 1 Region: 20-79
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000392
Family Transglutaminase, two C-terminal domains 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|557685440|ref|YP_008788913.1|
Domain Number - Region: 243-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0369
Family Beta-D-xylosidase C-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557685440|ref|YP_008788913.1|
Sequence length 314
Comment hypothetical protein M271_12240 [Streptomyces rapamycinicus NRRL 5491]
Sequence
MTGRDETRFDTLGPTLTVTTVPADPAGGDTVTATAHLTNDCPFPLRDAVLHLIGPGATTA
ARTLPLGNLRRGAKVTRSWRTAMPADVAGDVSFTAHLVFDVDGHSSDCARSARTVSVPYE
PNGVREPYTTFATTGDATFGQYAPGQLVIWAGGRDLSGGTDEKGVIYLPGAAAESCVVQV
RTAGLTGSDNPSAKSGIAIAGDLTAPGKGGYAVLTMSARYGLEFMTDSDGDGHLDTWAGG
GGSYHPAWLRLVRSGTTCTAYATGNGLAWERVGTATVPSASGAGDAGVIASAVNANYPGT
TVRAVFDHFSVEAP
Download sequence
Identical sequences A0A0A0NAS6
gi|557685440|ref|YP_008788913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]