SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557689200|ref|YP_008792757.1| from Streptomyces rapamycinicus NRRL 5491

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557689200|ref|YP_008792757.1|
Domain Number 1 Region: 60-340
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-40
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 477-575
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000469
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557689200|ref|YP_008792757.1|
Sequence length 706
Comment Ser/Thr protein kinase [Streptomyces rapamycinicus NRRL 5491]
Sequence
MPRPDPRTAVLADPEVPERKRFCSRGDCGAPVGRARGERPGRTEGFCTKCGHPYSFVPKL
SPGDIVHGQYEVAGCLAHGGLGWIYLAIDRAVSDRWVVLKGLLDTGDEEALAAAVSERRF
LAEIEHSNIVRIYNFVEHLDQRTGSLDGYIVMEYVGGKSLKDIANARRTTEGRRDPLPVE
QACAYGIEALEALGHLHSRNLLYCDFKVDNAIQQQDQLKLIDMGAVRRMDDHDSPIYGTV
GYQAPEISDSGPSISSDLYTVARTLAVLTFDFQGYTNVYVDSLPDPEHIEVFRAYESFYR
LLVRATDPDPGRRFASAREMADQLTGVLREVVALQTGRPRPALSTLFGPEPRVVDTELFA
DDGKDPSLLGARSGGGATAPAIPAQRPPGPLALPLPAITTLDGRATALALPVPLVDSDDP
NAGFLAGLLAADPAEVSAALRTAPVDSVELRLRRVRAQLELAQEHDAGVALTGLEAAYSD
DWRIVWYRGLHALATGDRETAALSFDAVYDAFPGEPAPKLALGVCAEVLGQLDNAAEYYR
LVWATDPSFVSAAFGLARVLLCAGDRPGAVRALESVPESSIHYTAARVAAVRARLRQRAP
YDALLSDLTASAVQVERLGEFGLDAVRRERLRTEVLGSALDWVLSGSSGAPPGHNRPPLL
GSSLDERGLRFGLERSYRVLARLAQRGEERIELVERANRFRPRTWV
Download sequence
Identical sequences A0A0A0NLE4
gi|557689200|ref|YP_008792757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]