SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_002737 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_002737
Domain Number 1 Region: 224-358,389-495
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.66e-61
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0000152
Further Details:      
 
Domain Number 2 Region: 54-222
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.57e-51
Family Nicotinic receptor ligand binding domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_002737
Sequence length 520
Sequence
MGRAPLPRPKGWPPRHTCLARGRVLGMQPAPSCRTLWVPGWVIDIILLETLESGHDERNQ
VMTTSLWVRQRWEDYRLVWDPADYGNITMVHIPIFLLWKPDIVLYNNVGGSYAITMLTMT
QVYPNGTVDWFPPAVYRSSCPINIHDFPFDEQRCPLKFGSWTHDYSKIDLQPISEFVGLE
RFWENQEWDIAETPIERHKLQYPCCDTETYVDLTFTFVLHRKSLFYVVTFVLPCCMIAFL
TIFVFYVTLCISILLALIVFLLLIAEMIPTTAGSIPLIGIYLLFSMAMVSVSITVTVIII
NLFHRSALTHTMPCWVKLVFIDWLPPYLHMKRPENYKSYYPQADQQEVDHSNNVHLTRMM
YGRNSDTDRQCFNRHPYLRGGCGTGSDGLPNLHNLGMDNEWQTHGHETEEEMLMDANIDL
KGLRDNGKTPARLKEGLEYLNYIVERTKDADKDHKVQAEWHYVAMVIDRIFLWIYIVIVL
TGSMGIFLYSPLLWETSDVHIPVPWEKPIEVNRTEYLNSL
Download sequence
Identical sequences W4XH69
SPU_002737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]