SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_003622 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SPU_003622
Domain Number - Region: 5-50
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0373
Family Pentapeptide repeats 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_003622
Sequence length 181
Sequence
MGHFLGGANVVGANVGGAIVASGGAIVGGAIVGGANIGGANVGGANVGGAIVASGGAIVG
GANVGGAIVDSGGAIVAEQLSAEQMSAEHLSRFAEQLTAEQLSKEQLSKKQLSAEHLSAE
QLSAEQLSAEQLSAEQLSAEQLTSEQMSRSKCRGAIVAFCGVNVGGAIVGGACVGLPIGN
T
Download sequence
Identical sequences W4XJP5
SPU_003622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]