SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_004550 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_004550
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0000000000000017
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_004550
Sequence length 179
Sequence
MPQYFAAIIVAVGLITVFTVVTCSIHHTGDSQRAPRLVRRAILGYLARFLCVQTIPVDDA
DDDLKKSSSSFTTGSVKRRNEVDGDGVLNPVFEDDDGNGDPFQASTSASNCDPIEMLMSK
ISRGVAHFAKLTFDEAESKRTSMEWMHIASVLDRFFTYFFAIICLAITLGTIVAAAAQA
Download sequence
Identical sequences W4XMB9
SPU_004550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]