SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_005131 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_005131
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 7.32e-27
Family Nicotinic receptor ligand binding domain-like 0.003
Further Details:      
 
Weak hits

Sequence:  SPU_005131
Domain Number - Region: 131-291
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.000602
Family Neurotransmitter-gated ion-channel transmembrane pore 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_005131
Sequence length 298
Sequence
MWTDEYITWNESEYGGLTHLDIDMDEIWQPSVTLITSNSDNHLTMLQRLGLVSSTGEITW
LSSIIITTSCMLDVELFPFDEQLCTIEFGPWARDRTKEDMEFFFDENEMSAQRYRQNGVW
AIVKDTAQPNYICVTVVVACTSLIFEAIVLRMYNLGDTRTVPAWLYRRCCSSMVTDSVPM
DTFLSLRDRGNATPSPKDRQPPQNDFDGLMGRQADEKQESGKECISGNLRQDKIEVNHTE
HHSTLNAVRIRGTSSENAEKWKRVATWFEKNVAILLLVVVFGNMLATCLVIVIKKSKA
Download sequence
Identical sequences W4XNZ8
SPU_005131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]