SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_005670 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_005670
Domain Number 1 Region: 39-244
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.24e-63
Family Nicotinic receptor ligand binding domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 244-485
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 2.62e-60
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_005670
Sequence length 488
Sequence
MFGENLLNTDDPRFLQSYSGFKLFHFVGVSGQTQTTDTLRLFTNLFANYSKDIRPVERAS
QSINVLYGMAIRQIIDMDERNQILTTNVWLRQGWSDANLKWNPDDYGGITKITVPSSNIW
KPDIILYNNADSSFKGAMKTNAAVSNDGNVTWFAPAIFRSSCKININYFPFDKQECSLQF
GSWAYTTEHLNILNRSASGDTGSYLVNDEWKLEDFPVIRTLPQYSCCKYPYSVLDFVLII
RRRPLFYVINMLVPCILVSALTLLTFYLPADTGEKFTLCITILLSLTVFLLLAAETMPPT
SEVVPLIAQYYITTMVLVSASTVLTAIVLYIHHRGTYVGRAPSWFRRFTLDYLAKFMCMG
DCHNPDVKDKIPKINFENASGSSGSSTEVVEAGLHSNEMPLELDVANLPTSQSGTCVQLD
RRGRIRFIMSQIASCLRQVVEHSEDGIVDEEIKGEWMRIAFVFDRFFMWLFGLSTAVATC
GVLLQVKE
Download sequence
Identical sequences W4XQI1
SPU_005670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]