SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006469 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006469
Domain Number 1 Region: 60-181
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.27e-20
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_006469
Sequence length 213
Sequence
MQNTPIHLVKLDTAQIVVANPNVSAEYNIIGSSTRSGYITLPDNVTYENMGLGFTLERLP
RFYVQNVILPITFLSWLSIFIFIIPAKSGERLSAAVSLVLGLTVFQIVITDNLPKNSRGK
TAPVISYVSECFIITIVVAIMSAIVINISHRKGFIQNKFFRSLFFEYVGPWFLVGGDGCC
KKKASGSNPKESCKVGDLEMEDKAGKSGLNIDS
Download sequence
Identical sequences W4XSS1
SPU_006469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]