SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006517 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006517
Domain Number 1 Region: 78-227
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.00000000000017
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0029
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.00000484
Family Nicotinic receptor ligand binding domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_006517
Sequence length 235
Sequence
MDLTLFPFDSQICQMIIASKDIITNVVLIPGVFIRRAEDRPLSWDLTSLVAESRSRENRA
GDHAVSDLLVIIHLERLPNHYVYTIILPVTLINAIGIWTFFIPLKSGERVTTCISVVLGV
TVFQRRIKNRFLRILFFRILATMVFKRQDGLRKMTERNVQSAKSDGQDLNRPNNFSLCEE
TRDNTPQVIQSRENVSEENDMELVAIIVDRMFLCTFLVIEICMIFMFRATFSDDA
Download sequence
Identical sequences W4XSW9
SPU_006517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]