SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006738 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006738
Domain Number 1 Region: 63-179
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.44e-19
Family Nicotinic receptor ligand binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 182-246
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.7e-17
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_006738
Sequence length 249
Sequence
MDQSQSDLCVTSDDLRMCPSDSFRDEENQHVKLSGHMRMVQAGCAPINCWCHSPNPLRFL
LRHSVVKDFISYADTYIIVSNDGTMDWYVQVIIAASCPIDITYFPYDVQHCNLTFGPWSL
KTDEVLLQKSTNADASGNRFRKNGVWILEQTISINLIFESCWYNLSWSAVHFTLQISRQS
SFYTRTVVVPCILLSALMVLVCWLHPASGEKVTLAVSNLLALILFQQLVADRLPPSGETT
SIIGKYAFT
Download sequence
Identical sequences W4XTI8
SPU_006738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]