SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_007455 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_007455
Domain Number 1 Region: 105-191
Classification Level Classification E-value
Superfamily Barrier-to-autointegration factor, BAF 6.28e-30
Family Barrier-to-autointegration factor, BAF 0.0000786
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000549
Family CAD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_007455
Sequence length 191
Sequence
MATPRMFKVWHADKKLVLATSLNELIDKGLTKLQKTRENFKCLRLSDGTIVDNDELFAFL
QESEPIHFVFSDKEVPSTSACRPTGASDQGVPLQQHGMAQTRAQTTKTHQLFVNAPLGDK
SVRKMAGVGSIIGAKLEAKGFYKAYVVVGRYLVLNKNKEYFMKWMKDEVDANEKQSSQCY
QCVKGWCDNFM
Download sequence
Identical sequences W4XVJ6
SPU_007455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]