SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_007767 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_007767
Domain Number 1 Region: 105-298
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.00000000000000183
Family Nicotinic receptor ligand binding domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 299-390
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.000000000000654
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_007767
Sequence length 561
Sequence
MVHIKVKRQNDSRRNSLPQPFVLRTNIGGRTRLRLPPRMLSTSALKSTGDSGLACQELFR
VWKKFKMSGDQSAEKLDTMLQSMDKIQMTLKQIEVNGRPGDSEEYYAPREDKQKVFARIR
CNIITVGDIDTVAQLFTAEIYLSVTWKEPKVKGMKREDVNWDEHWDPRIYFFNAVNIDKM
QTNHYIMPNDDDDPDGIPDVRLSIRMKGTFKCSMQLKDFPFDCQDLTIKLMSDWPVEDVE
FVKDMNIKDSIRLDTFTAGHQWKLWKHVLAQPIEEDKALTGAHRSYPIYHITTHVQRRPG
FYIWNIALIMLLIVILTFTSFVVERGAPADRLSVTVTLLLTAVAFKYVVSQSLPLISYLT
MLDKYVLSCLIFQCLVVGQNALSAVVEINDPDKEKDWAKWFDFISIIVLAGMVFNITIGF
IISSLIRKCKTTNRMTKITAEYMDKCEQINQNWQTRQSNREASRKSKEERTIPPTEKAVQ
AGAAAKGLSWKRTSKEVGNNGKNNVEMQGIKIQEYEIPPVNKVTTVTFTVKHRLRSNQIQ
EYGITPVNKLLLHSRSKHRLL
Download sequence
Identical sequences W4XWF7
SPU_007767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]