SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_008179 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_008179
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.36e-24
Family PB1 domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_008179
Sequence length 112
Sequence
MAAEEDGMIPIKAAFNGSILCIRIDPNVTLEDFLQDMRGICNFPEKQNFTVKWLDEDGDP
CTISSQEELEEAIRLYELNKDSNINIHGNYIGNLQALSYVHMAAFIFGIAPV
Download sequence
Identical sequences W4XXL6
SPU_008179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]