SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_008291 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_008291
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000157
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Weak hits

Sequence:  SPU_008291
Domain Number - Region: 179-230
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000183
Family Pentapeptide repeats 0.018
Further Details:      
 
Domain Number - Region: 710-952
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000421
Family Rhodopsin-like 0.031
Further Details:      
 
Domain Number - Region: 149-170
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00131
Family Somatomedin B domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_008291
Sequence length 1003
Sequence
MAVFSTFNLEDSYDSLRIGSGLDPDDTASLLATLSGSILPDIIVSNSNEMWLVFTSDVSV
TELGFRVNIEVYTPGNYADYTDFSLSSDFLDMSSIDSKDFMTDSSSSPDFPDISIFYSSD
SVINASAENMDLNQYADNTCFEESCLDGQETLCRCDDMCQLFGDCCPDYPIPISSGTLSN
EILSNETLSNETLSNETLSNETLSNETLSNETLSNETLSNETVLDIDVWECIVDSFLPLF
YPFLGHGYRMIARCPSRWSLEEDVKRNCEEVSPNATIDVLYIYQDTYFRNLDCATCHGYT
ESSLTAVVISADQKCWWGYNNTLACMTPMPTLQSNVSMNISRSDIMPSVQTIQKPRLCLV
NTTGSCPNGTNEEIARECQFYYKPCISEGIVSKHPACSYCNGGSMGISSPSGSDDSLHYD
YYDSSMLDGADGLVDIFQMLNAPIAAPIQTFCLEGFELDGNGYCAPLSSDWPVCQSRHFG
VKQSKGTVECLEEMVCFREVTVDNITTSAKVPPPCLVRSSTDEINDIITFNLLYRDDMNP
SLYTIQSDIINRIKNPSRDGCNDIVISASQFCHVEDNPGNITYRCPEEMFVGYCLDFTPF
LTNNESLIFFNGTYIRPKWWSNITNMQFSSDNVSSEYQFVMCGTEIALQTCSFFTVSNDS
IEWDYQGNQSVILYQGQMYDTEDILIHPDGSISICYSDQVTPIDSRTLMIIGHVLFAISS
VCLFATLITYVAFSTLRNRQGVSIMNFIVALFLGQIFLQYMRLSVSQFRIPCIVVAALSH
FFFLASFVWTTILAWDLSRSFAANKIKSFSSSSFGRKMVAFLVIGWGTPLVFVSITLVLQ
FGRFQNGPFLEYDSNTCWLTKLSSIVMFFVPMSVCLLSNLVFFIITVHGVHSTKKATSVL
KSGQDSHFKQLAVELRIYVKISALLGFAWLFGFLAMVTNVPFMEYLFIIVISLQGVFIFI
SFGTNIRVKKLWRTFVENSSLLSMSKFSRGSTGAHDGPKSEKH
Download sequence
Identical sequences W4XXX7
SPU_008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]