SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_009399 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_009399
Domain Number 1 Region: 139-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-72
Family Protein kinases, catalytic subunit 0.000000658
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.36e-45
Family PB1 domain 0.0000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_009399
Sequence length 424
Sequence
MAAQPLVIRIKTQHGEDVDWTVQLGQLSFHEVLEVIAQVLQDNTPAAFEYEDEDGDRITV
RSDDEMEAMINYYLSLLAECEARRVMAPPLNIYPQVKPGGRKNIHNLTVNTRPAGAVPKG
ADSGISLGYGRHDAELREILASGRIVETDILHLEVLGRGHSGQVYKAKHVPTNNVMAVKV
IPLDITPEAQKEILSELQILYKCDSPFIIGFYGAFFTENRISICTEFMDGGSLEMYRCIP
ESILGRMTVSIVKGLNYLWNLKIMHRDVKPSNILVNTQGEIKLCDFGVSAQLVSSITRTY
IGTNAYMAPERVLGDEYGVHSEVWSLGVFLLEIKKNYCFPFPIALLQCIVEEHPPRLPSD
KFSAPFVDFVNRCLQKRPGDRPKPQDLMQHPFIRIFADGNKQIISEWVCQELQELRLRGT
VKGL
Download sequence
Identical sequences SPU_009399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]