SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_009498 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_009498
Domain Number 1 Region: 110-341
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.09e-30
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00034
Further Details:      
 
Domain Number 2 Region: 5-107
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 5.49e-24
Family Nicotinic receptor ligand binding domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_009498
Sequence length 352
Sequence
MDHDVVIVRPDGMVTWYSSAMLYSSCLVRVRYFPFDRQYCRLILASWTHDNTSVTLKQKN
ETVRKEYFINNGVWDLTNIGKEYQVLKWECCPNPWIEAHYLLLFQRQSRYYVITVIVPST
TLSLVSLLVFFMPPDSEEKVTLASSNLLAMLLFQELVSTSMPPIGNQFPLIGSFFVASIV
INTFSIFTSIMIMYLHNKDNRPVPTWLKKLAVLKTASNQSQPTDARPNWVERRLSGFICA
STVSKAVQVRHAQDSGQNAIGTNQISSKYLTLSTVPETKIKKQEDKANGNPNADGANPSQ
ETKEDIIAQWQELSIKVNRIMGFLLTSSVMLTALVITFLYIAQEDGEFPART
Download sequence
Identical sequences W4Y1B8
SPU_009498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]