SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_010325 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_010325
Domain Number 1 Region: 33-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000068
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 2 Region: 151-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_010325
Sequence length 215
Sequence
MAKSLRGLASFVFMVMSVGLVHAEHSECEDFKDYFSTLVSPDYPDPYPPATRRQWYMEIP
EGVQALIRVNALEIERTWDYLTLEHTHQTAHGTNVTRFPLVSGNVTSILLPEGNVMLDFC
SDEFENFDGFSFDLRTREINNTFDLGCYEPDVETFACASGVQYIHAIARCDRIVDCHDHS
DEIGCGGEDEREEERGEEERATERRERWREWERER
Download sequence
Identical sequences W4Y3N8
SPU_010325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]