SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_010629 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_010629
Domain Number 1 Region: 414-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.93e-82
Family Protein kinases, catalytic subunit 0.00000999
Further Details:      
 
Domain Number 2 Region: 71-151
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.89e-28
Family PB1 domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_010629
Sequence length 681
Sequence
MRFQRALEIITLTLAPAAVSAHSAFQGIILPVDPAADSNQVISEITDNLISLRVQGNRNR
GRGSSSSHSTEIRVKFEFNGEKRILQIPRPLKYDDILLKARTTFGQPVDMFLTNHNTTFS
LLIPIRDQTDLNHAVEITDNNPNAKSLRLHLELATPGSSSNNNGSSKRDLYDTAIRSSST
IPQSKHTSPSRSQSVPQDHHVHTSHDTTHKRYSTQEMPTRDNANPSPPPGYVPANAMVDM
GHQSRLQTFGEGTFIPEPPEERIMVSPNGSQQSLDKLRMGSHSLGSATGKMFKSQSCANH
DDFENSQVGRGMIKGGTFPSRQSVKPSRIDTEDGRKTFPSRGKRPPLASMHDDQHSISDS
LSSLGRSSSSGISPDYDTDSSIPRRWTEGDLEGLAGGHPKSFNLADNTRSPRAPTNWQRG
KLLGQGAFGVVYVCYDADTGRELAVKQVPTENSNTDARKEVQSLKQEIELLRNLQHPRIV
QYFGCLEENGTLSIFMEFMSGGSVKDELRLYGPLTDTVTRKYTRQILEGTAYLHDHHIVH
RDIKGANVLRSSGNVKLADFGASTRLQTIHSHITGMKTVTGTPYWMSPEIINGEGYGRRA
DVWSIGCTVVEMLTTKPPWADYEAMAAIFKIATKETEPVLPQSVSQDARNFLTLCFKKIL
ADRPSAAELLRHNFVRTAPMD
Download sequence
Identical sequences W4Y4I9
SPU_010629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]