SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_011220 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_011220
Domain Number 1 Region: 20-231
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 6.02e-65
Family Nicotinic receptor ligand binding domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 233-489
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.53e-60
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_011220
Sequence length 492
Sequence
MYCEVTSDKLEKPETKAGFHERNLLRSLFDDCPYRDLTRPSNDPSEPVRVEMGIALQQII
DVDEKNQQIISNLWMTVRWTDPTLAWNKSEYGGLDKIRVLPDMIWRPDILVYNSAAPKFD
PTFHTKVTVTSEGLCEWIPPGIFKTSCPIDVTYFPFDIQECEIKFGSWTYGGFTVDLELL
SDEVAMNDTSEFVKNGEWNLIGMPAEKKIKNYTCCPETYPSLHFYITIRRRALYYTLNIL
VPCLVISSLALVGFTLPVESGITILLSLTVFMLLVAEAMPATSVSVPLIAKYFDCVLMMV
AVSVVFTVITLNIHYRHPNSHVMASWQRSLLLEWLPWLLYMKRPGREWSPCQPKPSRDDM
GPPVFSHVGPSTEIQLMDRSPKRKVGTNGMVPQGTYLNDAKTIGIKYANYAHEESEPMML
DHKACKEGNSREQLDLIIREVRFLTERYKLKDMEDDEIHDWKFAAMVIDRFAMVFLTIFT
VVATVVILSDHP
Download sequence
Identical sequences W4Y672
SPU_011220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]