SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_011606 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_011606
Domain Number 1 Region: 453-626,668-713
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 2.75e-37
Family Nicotinic receptor ligand binding domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 84-218
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.74e-26
Family TrmB-like 0.064
Further Details:      
 
Domain Number 3 Region: 715-908
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 2.88e-26
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00027
Further Details:      
 
Domain Number 4 Region: 253-383
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.52e-26
Family TrmB-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_011606
Sequence length 919
Sequence
MTTAHIVDLDVMSSTEKYQLPAHRLDCLRPGTHLGQSMDCALGIPIYSGAFYDMLEILKK
DGPRGHTQSTIEPFHEFDKNYLRAWYTDTLVQEFIPSYPEIQAKLEMGIRMLDVGCGAGL
ATQILAKKFPESHFVGVDIAQSMVDEANAEATRLGLKNVSYFRVDGSVMPSDWASTFDHA
FFFNMLHDTSRPDLLIDDVKRVMKKDGTLSIIEFDFGSKVGDNVGNTTAPLVYTISLFYC
LPQAYQPEDSHGLGTLWGRERIQDFLKEKEMGIRVLDVGCGAGLATQILAKKFPESHFVG
VDIAQSIVDEANAEATRLGLKNVSYFRVDGSVMPSDWASTFDHAFFFNMLHDTSRPDLLI
DDVKRVMKKDGTLSIIEFDFGSKVGDNVGNTTAPLVYTISLFYCLPQAYQPEDSHGLGTL
WGRERIQDFLKEKVQASDKNMTTAAPPNTIATEKELVEKLMSSYGDASVRPVRNHSQPVV
VFFRMLLYELIKLDETRQIVNIRTNMRLQWVDEYLQWDPEENGGIYNLTLKMHQVWRPDI
FLDEEFISKLHSFFSVDRDFISLPEAETFVIVQHTGAMDWLFPAVTTSACKMNIEYYPFD
SQLCVLTFYPWTLDESKSHRKDQHQTDNRSNDNITLDLYPRVGRFGVSLNSVFNGVTGMR
LFAKNDEDAFQARYVKNGIWSLVSFTATNRSIKYLCCPYPNDHIEYRLTFLRESGFFLTN
VVVPAIFLTALMLVGFWLHPDSGEKVTFTVTNLLALTLFQQLVADKMPPIGEPRSILVTC
FFMLIILSGCAVFLSVLVLRLYHHDTNTRPPRWVIKLIMPWFSRSGARGYIRKIYIIEKE
SKVTTNEEVLTNGNTATTILTTTDVKKDEVRRLAFDSESKDVNQFVWRQVALAFDSLCGT
VLCCAMLGNFMFALISFLK
Download sequence
Identical sequences W4Y7A2
SPU_011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]