SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_011607 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_011607
Domain Number 1 Region: 36-191
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 7.45e-35
Family Nicotinic receptor ligand binding domain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 407-620
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 4.97e-25
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00052
Further Details:      
 
Weak hits

Sequence:  SPU_011607
Domain Number - Region: 350-405
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.00106
Family Nicotinic receptor ligand binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_011607
Sequence length 631
Sequence
MEATWIMFVICPLLCLSSQVHSDEGYMNDTSAKALVRKLKLEYGDVSVRPLRDHREPIQV
GMRMLLYELIEFNENQQKIKIRSNMRMKWTDEYLQWDPDEWDGIYNITLHCNDIWRPDLT
LVQNLHKDGISIDETYVNIQHTGSVDWLFPAISTSACKINIMYFPYDIQECNLTYYPWSL
VNSQLLLRHLLRRKLVLKKRKLARRRQMHFWIREQFFSGSICLLRGTPDTSAERLSSTGY
MYFGGVAIIVVVALIVFYGALLGRRKRRRSKCRRSKCRRSKYRRSNCRRRGMSTKQLSAE
KLSAEHLTLEQMSWSKFSEEIVAFLKSICLQSNRHRSMCRATLSIYIGGGMRLFALTDDD
ALQERYVRNGIWRLTRFLPSNDSVQYKCCQDPFDRVVYTLTFARETAFFSTNIVIPAVFL
TILMLIGFWLHPDSGEKITFTVTNLLALILFQQLVAEFMPPIGEPRSIIVTCFFILITLS
VCSVILTVIVLHVYHKDVVSRPPSWAFWLLRIFIHSNAEGKMSDYYKYLEAKQCERRYST
IQYICDTVQLATVLDNKPPSSSDSAGESSSLREGSIDFKALKMRSPMELTNGFMWKQLAH
GIDRAFGTILSACMLGCGIYAVVSFSQAPKG
Download sequence
Identical sequences W4Y7A3
SPU_011607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]