SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_013095 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_013095
Domain Number 1 Region: 181-424
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 6.54e-65
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00004
Further Details:      
 
Domain Number 2 Region: 13-153
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 7.45e-37
Family Nicotinic receptor ligand binding domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_013095
Sequence length 430
Sequence
MSITRPAKRDATIPFVNKNPIIISLLISFHIIQDERLQQLKTNVWLTYVWTDEFLRWDPA
DFNGLKSFKITSDLIWMPDIVIYNNAADSYEPYMFNKIVMVDHNGRVNWASPIIIQSSCQ
LDVANFPFDYQKCHIKFGPWQLDGSELTLNGSELIMKCFSDKTYRFLTFCLICPSSYRRA
MYYVFNLLVPCILIASITLLGFLLPVDSGEKVSLGITVLLSLTVFLLLIAQSMPPSSVVP
IIGQYYVSTMVLVSISILLTVSVINLHHRGPYCRKAPRWVRRIILGKIAWFLRLQPEHFK
HMKFASNNSYYNANGINTSSPSGNNFRKKRESYKRDKVKVTAPHESPILGISRSGRGREG
CCDNNDDQLILLRRMIDHMRYIRDHFEEIDDSEDIKNEWKQIALVVDRVFAIFYVFGSIG
TILMLVFKIS
Download sequence
Identical sequences W4YBH1
SPU_013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]