SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_013639 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_013639
Domain Number 1 Region: 9-78
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.000000000000902
Family Nicotinic receptor ligand binding domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 84-166
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.00000183
Family Neurotransmitter-gated ion-channel transmembrane pore 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_013639
Sequence length 207
Sequence
MHMNVWRTLNCSLTFGSWINDNSRIVFDTRSTGVGLSHFSDNPMWHIVETSVQKHAIVYA
CCEEVYEDVTFYITISRRESHGRIGPAVVSVWLILAVFLMQPSKGGERIIFAGLVFVSLI
VLNAALSAEVPAYSVTRLGRFLLAGMLINSIVVVINAIIYRFYPAEQQGTTKAQSSFSAP
RVFFLLDVAVALILFVVLTILTGALFS
Download sequence
Identical sequences W4YD11
SPU_013639 7668.XP_791651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]