SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_014121 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_014121
Domain Number 1 Region: 127-368
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 2.49e-60
Family Neurotransmitter-gated ion-channel transmembrane pore 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_014121
Sequence length 371
Sequence
MHPAVRILGLHHGAPESPEPLGLGRHCQFSRQRRMEIGRFPRDPDPAPVWLLQVPVLRSR
FRAHYQEKYYRYKQRKLVVQLVRPSAVAILRRCNAADAQYLLELETIAQGHGEVFRCEKC
ESSEIWPLFYVINMLVPCILVSALTLLTFYLPADTGEKFTLCITILLSLTVFLLLAAETM
PPTSEVVPLIAQYYITTMVLVSASTVLTAIVLYIHHRGTYVGRAPSWFRRFTLDYLAKFI
CMGDCHNPDVKDRIPKINFENASGSSGSSTEVVEAGLHSNEMPLELDVANLPTSQSGTCV
QLDRRGRIRFIMSQIASCLRLVVEHSEDGIVDEEIKGEWMRIAFVFDRFFMWLFGLSTAV
ATCGVLLQVKE
Download sequence
Identical sequences W4YEE0
SPU_014121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]