SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_015639 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_015639
Domain Number 1 Region: 35-215
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 2.09e-43
Family Nicotinic receptor ligand binding domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 227-300
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.000068
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_015639
Sequence length 343
Sequence
MFQASGDQNNILSHEVLLGIINAVLHGNVDKDNRSTGYDKRLLPTHNESLNVNIQMSLSS
LREMHWVDPRLVWNPLEYGNISKFRVHSSEVFVPDITLYNSHSPSKTMSDDISTLMTNHG
TVYYTPPVAIEAACSLDLKDYPYDSHICRLKWGSWVFSSMRISVTPASDTIDLNDYHAHP
VWELVNTSAVKNVVSYPCCAEVYEDISFHLTVRRRESHGRIASAVIATWLILIVFLIGPS
SAGERIIFAGFVFVALVVLSAALSAEVPAYSMTRLGRFLIGGMLINAVVIIINGLIYRFY
PKDQPGHMKEGDGTISRVFLFIDIGAFLGTTIILAITTGALFA
Download sequence
Identical sequences W4YIN7
SPU_015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]