SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_015655 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_015655
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.7e-44
Family Nicotinic receptor ligand binding domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 163-228
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.92e-24
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_015655
Sequence length 272
Sequence
MTANTFMTQEWNDAFLQWEPSESWNITDVQVPINNIWRPDIILHNNANDELNGGIRWTHA
WIRYDGTVTWKTNYILMSACPMNPLYFPFDTQNCSLKLGSWTYNEDEINVIANSTSGDAT
QYQPNGEWDLIDFPLRREVDVRQCCPGAYPSVIFNVIIKRQFLFYFFNLVVPCVIISSLV
LLSFVLPSDACERITLTLTVLLSLTVFLLLVAETMPPTSEVVPLIYYYNNRPVQSGATPT
DRKRHKLKRPVLKDTIMAAGRVSRVKGTEGLQ
Download sequence
Identical sequences W4YIQ2
SPU_015655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]