SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_015801 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_015801
Domain Number 1 Region: 117-224
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 4.19e-21
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_015801
Sequence length 256
Sequence
MLSHPHITIATSTFEGRPEKQLVSDLLANYGPTSVRPVKNSSTVSEVFFRLLPKELIGFV
HFQLSKQGDTTIDIFNRNGVWILERSGGINKDAVLCCDNRTWSIIEYNITIRRMSKFYTK
TVVVPAFLLTLLMAVVCWLHPASGEKVTLAVSNLLALILFQQLVADRMPPSGETTSIIVS
FFIVMIAMCCAEVLCAIFVLRIYHMGGQTEVPWLLRRVMLCPFILPLYNSQESKEVFRAQ
QTNYKLVRYERNNQPR
Download sequence
Identical sequences W4YJ41
SPU_015801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]