SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_015821 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SPU_015821
Domain Number - Region: 146-200
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000602
Family Pentapeptide repeats 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_015821
Sequence length 580
Sequence
MGGNVRISSPFSRKTKLVAGNPVSGSSCPLEYDTLVLRPPGQAQMGQCEEVVLVLRDPSA
TTEPSKTSKPMITTQPAPTTTLEPATTIPQTTPTTLPPTPPPTGLTVLTMDGSTQQALLP
NVQVRIIRPAIEIFPVTTTTISPITNSSMTNSSMANSSMTISSMTNSSMTNTSMTDSSMT
NSSMTNSSTGNSSMTNSSTVNDSLITAYTTGDGLALLDIPLDEPVIVVASKAGYLETSFT
YCFQPGVKNVLPILIHKHSFTEQFVWMSEEDHSVEFRHPEHKIPYRLDIPAGSLNVTDGS
VVEVRFSGVHTSHPTELKEVPELIGATESPDGMKLTGLEAFSMAEVTVVNAETDDLVDVV
LPFNAVFPLDRKPRGAHHGTKIPAWYFDKMTGTWKEDGIGKLKNKAGELVWSFQARHFTW
WSAIQPWPETSCLIIKTCYEKNCKRVASFVPVEVHGVDFSYTSTSVTSGEGQTCTHFKMG
GQVRVSSPCSKKPKFRIGELGGTTYCPENTQVLRPQDQTETGRCEQVVIVVRGKIIMKMI
MIIIIQLIILLLIIIIIVIINNIITIKIIIINIIIIINLY
Download sequence
Identical sequences W4YJ61
SPU_015821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]