SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_017132 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_017132
Domain Number 1 Region: 227-345
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.57e-21
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00064
Further Details:      
 
Domain Number 2 Region: 60-227
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 5.75e-21
Family Nicotinic receptor ligand binding domain-like 0.0047
Further Details:      
 
Domain Number 3 Region: 6-58
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000183
Family Ribosomal protein L11, C-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_017132
Sequence length 400
Sequence
MSTNHKALSHSGNIGLDVIIEIAKTMRERSMARELKGTVKEVLGTAQSVGCTVDGSNPHD
IIEQINDGAIEIPALWHDHRLVWSPEDHGNISLVSVPLNSVWTPPLQMFNRAGSGQTQSP
FQTDGNRVQVWANGTAYMQSNMYFSTICSVLLVEFPFDEHNCGVGFFPLGINSVYIKFIP
GLALSLANYNAEWRVNAMESEASEKQDAFSGKRTPFLDIVIFLERQPNFYLRNILCPLVL
FIILAFSTFWIPIKSGERVSASLSLVLGNTVFQIIITDIMPRTSNPADEPLIVYFCVSSF
ALITAITVWSMLVSNLSFKKWSLKNSAARRFFFDVLPVLTLSKPLRCCRSRIAAEDISME
DKSTHETTEVQLFDHTAAHTPVHRAQHYPVEESGDDSQVY
Download sequence
Identical sequences W4YMV5
SPU_017132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]