SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_017914 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_017914
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 5.23e-18
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_017914
Sequence length 219
Sequence
MILVSLSLVLNVIVVSVYNCGNCGDPLPHWVRVVALHVLAPIVRVKVESKRFPPSRAARH
ASGRPSAGHRVTAKLREKAYEKVPLKEKSLNNHSQQYTVGDPYSMHNGGGMEKENSHGGM
YAGHFQKIAGELRRMNDILITITTEALSVDKKTSTKEKAIQKEWLQIAKVLDRVFLTLYL
LGNAMTVTYLLVTIHQTSSILEDIQHAQDNNLEAHYNSA
Download sequence
Identical sequences W4YQ38
SPU_017914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]