SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_019886 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_019886
Domain Number 1 Region: 22-54
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0000000000144
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_019886
Sequence length 55
Sequence
MEYLDHGNFSKIEVTIHLSRRPLFYIMNMINPCVLIYGLTLLSFCLPGESGEKVR
Download sequence
Identical sequences W4YVN0
SPU_019886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]