SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_021097 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_021097
Domain Number 1 Region: 104-224
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.19e-22
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00092
Further Details:      
 
Weak hits

Sequence:  SPU_021097
Domain Number - Region: 59-102
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.000602
Family Nicotinic receptor ligand binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_021097
Sequence length 419
Sequence
MTHKGRLILTEIKRLRLSEYKRSAVISLSRSKANCVDYPQIESTIVSEASSELNWLIAFC
SVFLQNGVWSLQNSVAHQKNETYACCETPYSQIVYELILERSYGFYVLNIVLPSGLLAFV
NCLVFLLPPESGERLQFAVSNLLAAILFQQLIGGIMPPLGDELPLLGMFFVYMILTNCFV
LGLSICILRFYHQRGDKAVPMFLRRICFLKRGKEKSTLKRHANLKCLLRGGASRRLPGRD
EDGFSTTIAIAKRRVAPVKTQPPHCRRQRCPLRVGDPDIAMGEENFNQYPIAVGAEQKRM
ATGLACLRQLSFSVHRFSDGRRRRCHSDIIFYPVTKRRLNNDFNAHLVCDEFKYCCSDYK
YSQTCLLRPPKGNTKMTTVDKWLLGRVLQHTFPSRERQYRWPKRQISITKFHFEFMKFV
Download sequence
Identical sequences W4YZ20
SPU_021097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]