SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_021158 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_021158
Domain Number 1 Region: 28-233
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.27e-64
Family Nicotinic receptor ligand binding domain-like 0.00061
Further Details:      
 
Domain Number 2 Region: 233-474
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.14e-61
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_021158
Sequence length 477
Sequence
MKIVVFIAVSFIAIGAGVSGQTQTTDTFRLFTNLFANYSKDIRPVEKASQSINVLYGMAI
RQIIDMDERNQIITTNVWLRQGWSDPNLKWNPDDYGGITKITIPSSNIWKPDILLYNNAD
SSFKGAMKTNAAVSNDGIVTWFAPAIFRSSCKININYFPFDKQECTLQFGSWAYTTEHLN
LLNRSASGDTGNFLVNGEWKLEDFPVIRTLHQYGCCKYPFSVLDFVLIIRRRPLFYVINM
LVPCILVSALTLLTFYLPADTGEKFTLCITILLSLTVFLLLAAETMPPTSEVVPLIAQYY
ITTMVLVSASTVLTAIVLYIHHRGTYVGRAPSWFRRFTLDYLAKFMCMGDCHNPDVEDKI
PKINFENASGSSGSSTEVVEAGLHSNEMLLELDVANLPTSQSSTCVQLDRRGRIRFIMSQ
IASCLQQVVEHSEDAIIDEEIKGEWMRIAFVVDRFFMWLFGLSTAVATCGVLLQVKE
Download sequence
Identical sequences W4YZ80
XP_001196576.2.5271 SPU_021158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]