SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_021787 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_021787
Domain Number 1 Region: 10-116,243-361,423-600
Classification Level Classification E-value
Superfamily L domain-like 1.05e-46
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 663-824
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.05e-22
Family Toll/Interleukin receptor TIR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_021787
Sequence length 829
Sequence
PNNLINDLRALDLSSNFIRILRNTSFLMYSLLXKLDLSNNLIGFMDLPTFFPVDQLISLS
LDHNPIFTLPGSDIFQESKRLSSLSLQFCNLSYFPNDTLGFLPQLQSLDLMGNELTYINI
SKCPKRTLTMLDFSSNTFQEISADVLSLPCRTDTLCLGGNSFRKIDADVVADFPIRALVF
EFLILGSGQTFEVWKNLFTGIAHSEIDEIFLLMAFTDVPPDFFDPLRGKRLSNLKLQQNE
FKCYPSIFANLTSVYKMELISFHIGVLEPAFFDGMKELRSLTATNTKIEQVNPSGSSWKI
DLRELDLSENNLGNLSPFAFKGLTNLTFLDLTNNAQLMETPTTSLSGLDNLRTFNVSRTR
ISAQMTLHAPLLEKFVFTFRPCDWWRSLSALIPGKTFQYTPHLDCIELDNSYVILRELWD
SSENISLFQGLRNLRYLGLKQNKIGSLPFGVFDSLFKLQVLDLSDCEISTIESGAFASIT
SLTTLSLQNNNLQILPLHIFDNLIHLSTFFIGNNALFYIDKALFAKTQMITWIDLARNQL
SVFNQTTFSQISTTLSSIDLSQNPIECSCKSQWLIMLLRGAINVQNGKETTCSFSSPKPF
GGEALEFIQPNDLCTANVYVYFLTVFFVVIVVIVVVIVYHYRWQLSHKLFLLRLAILGYI
EIMDENDREDYDSDVCIISARGNDENWIQDKLKPFLQRFLPHYKRIINVFEDNDLPLGMH
RTDAIDHVLTRSYKILVLLSNAACVDYWFLKYFRMAIDQVDETQTENMVVVFLENIEEDK
IPYDVRKYMGGQGPFVEWVEDDEEGQTYFWKRLEKYLSVNLKRNHLIPA
Download sequence
Identical sequences SPU_021787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]