SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_022491 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SPU_022491
Domain Number - Region: 145-202
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0488
Family Neurotransmitter-gated ion-channel transmembrane pore 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_022491
Sequence length 433
Sequence
MSQKGSCILHGVIHRIVHLSMTGRITLIIMHRLPASKSSLVNDSGKVAYPGFSDGDYIGC
YPQGCLHFDYIVDISEPITPDSCTATCKENGFLMAGVYNGTECSCSCEQTCRNKPLHDDN
CGLPCRSAPNKLCGGYTAVSVYTDPPPESLLVHSITIYIYIVIILVVAGVLVTVITKKCR
ERINTERHRMSVQDNRVQNRDDRVATGTQYQPPRAMPKLSYIPQADATAPASSGTEMKDC
IYEEPDLGGSFVPTTGTVLAHEYLVLGQKVPPGIRSSEEYHEYNYPEMIQRKPMDLLMAS
RVGDDGYMIAEPETQGLPNPGSKVYYSSRLPISQSKGEAETSPTPFSKVHYSSRIPISVH
QGGSGSSRRSDTKPFSAHISGPVHRDILGLSTDPADPTVYYSTRLRRSGNQSSELSSEMD
NREDDGYIEVEGN
Download sequence
Identical sequences W4Z2Z4
SPU_022491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]