SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_022640 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_022640
Domain Number 1 Region: 205-292
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000091
Family DnaQ-like 3'-5' exonuclease 0.017
Further Details:      
 
Weak hits

Sequence:  SPU_022640
Domain Number - Region: 135-175
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0196
Family Pentapeptide repeats 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_022640
Sequence length 306
Sequence
MAENDELSGRVVRIDRNFANISVSGRAGNARLDRSVARRITGSYIDDVRDILEMNAQVKV
RIVPMSEEALSKFPQRIRMTVRRNSQWEVKFFRRDIEPAAAPQVSQFNVPEKTLEKQPPS
TTGKTIQTAAASATGASATGSSATGSSATGASATGASATGASATGASATGASATGSSAAG
SSASSSSAAAGSASGGPVDFKDVLSQTEIIDSVGACNRVLDPILDQSRRETVVIGLDCQG
VNLGKKEGCLTLVQISTWDKKAFLFDAFKNPQLLKGNSSLKKILEHDSILKVDLCDYNNN
NLIVME
Download sequence
Identical sequences W4Z3E3
SPU_022640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]