SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_023675 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_023675
Domain Number 1 Region: 14-217
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.83e-50
Family Nicotinic receptor ligand binding domain-like 0.00015
Further Details:      
 
Weak hits

Sequence:  SPU_023675
Domain Number - Region: 229-304
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.00011
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_023675
Sequence length 345
Sequence
MGMLTRTTANQAVETRLKADLFSSYDKRLLPTHDESLEVNIRMSLSNLREMDSFQGSIKM
NAWLFMHWVDPRMVWNPLEYGNISKFRVHSSEVFVPDITLYNSHSPSKTMSDDISTLMTN
HGTVYYTPPVAIEAACSLDLKDYPYDSHICRLKWGSWVFSRMRISVTPSSDTIDLNDYHA
HPVWELVNTSAVKNVVSYPCCAEIYEDISFHLTVRRRESHGRIASAVIATWLILVVFLIG
PSSAGERIIFAGFVFVASVVLSAALSAEVPAYSMTRLGRFLIGGMLINAVVIIINGLIYR
FYPKDHPGHMKEGDGTISRVFLFIDLRAFLGTTIILAITTGALFA
Download sequence
Identical sequences W4Z6B3
SPU_023675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]