SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_023734 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_023734
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 7.32e-40
Family Nicotinic receptor ligand binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 186-299,332-413
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 5.49e-36
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_023734
Sequence length 436
Sequence
MRDAVHVFLDVFLASLDGIDEKHLDYSITATIHQRWHDPRLTFNGTTTLPPTAYLVDRVW
HPNIVIGNAKEVLLHHISDTNQYVTVDWDGNVTLVQRLSVKLSCAMDFHRFPMDTQKCNM
DLQSFGLTTSDLVLLWGAQKLEFHSHHMRLPQYYMTGVDFFDCTEQRYNGIFSCVRAQFT
LERTLGYYMLQAFIPSIALVMVSWVTFWIDVRASPARVGLGVTIILSVISKTNGVRLDIP
PVSYLKAIDVWYTSCLFFVIGALLEYALVHHLSLGQKKTKQKVLAFIPKQGSSSQESAMG
VSHGTTESISAPCRISRQHQVIRRDETTGELRTTASAPPLDNKHPQPLQTTSPSGRQASA
LGRETSRMQGQEVSTCYHCNSMPGETHVIDLISRWLFSIGFAIFNICFWAYYLPTNYTPE
YLTNDEKFVSHSVGNL
Download sequence
Identical sequences W4Z6H0
SPU_023734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]