SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_024673 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_024673
Domain Number 1 Region: 31-452
Classification Level Classification E-value
Superfamily Sema domain 9.29e-66
Family Sema domain 0.0027
Further Details:      
 
Domain Number 2 Region: 465-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000157
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_024673
Sequence length 543
Sequence
MAWKGLEALLLFLVLISCQTWSIQSAPLSSYLVSSFTPPDSESTLPFNHIAINNITGDVY
IGARERLYQLDSKLNLKHTVDTGLCPSPNDENVNDNKLLAVVITPKNYLLITCGGCDGYC
ESRSLTNISHDVIRYNPADSQRVVTTNDVPTVGAVVLGADFVDDVEGTNENFYLFTGVSD
GQSSFISKRNVLYLNFVQGIQRFSSLTENVFKHLIAYRDYLYYFISRRTSMYIGRLCRNS
LDQYFESYTEIELQCGSHNMIQSAHIGPAGPQLADALTMNSTDALLYAVFSNEGSSALCV
YEMSDVQQSFDVAVLGCIHGTSNGTTNRYLRGSMCSDYPLWLSPPDSVQCTAYFRDGDVW
NTLHRYASGTVPLSASPIITMPDVIPTSIVTTTERQHTVAFIGDTQGELHKLNIVNSSCG
YVYEDVFLGGGSVLQKMFLDESTELLTLATSSDEGSKVLTLGLVNCGQYQSCGECIGEEG
GNDGDPYCGWCTLDARCTRYEACPFPDESTRWLSYNALQCVSISDVHPDHRLPYQETEQD
VSR
Download sequence
Identical sequences W4Z948
SPU_024673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]