SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_024832 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SPU_024832
Domain Number - Region: 100-169
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0608
Family Pentapeptide repeats 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_024832
Sequence length 209
Sequence
MSSEQMSAEQLSLQAEQLSAEQLSAEQMSVEQMSAEQMSAEQLSLQAEQLSAEQMSAEQL
SLQAEQMSAEQLSLASGGAIVGGAIVGGANVGGASVASGGANVGGANVGGAIVAFCGAID
GGAIVGGAIVGGAIVGGASVGGAIVGGATVGGATVGGAPVGGAFDVGANVAEQMSRSNCR
VLRSKCRRSNRRRSMCRVTMCGLNKTCRF
Download sequence
Identical sequences W4Z9K7
SPU_024832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]