SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_025266 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_025266
Domain Number 1 Region: 176-280,311-414
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 9.42e-46
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0041
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 2.62e-42
Family Nicotinic receptor ligand binding domain-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_025266
Sequence length 428
Sequence
MYVYSMGPITESKMEYTLDMYFRQQWRDERLQFDAEVGLALNAETLDSFWVPDIYIINEK
SAAYHTVLYKNSLLRIEPTGEMLFSTRLTVTASCNMDLSTFPFDKQRCSLDMESYAYSED
DVKFKWLENGPVYVDPKISLPQFKFLDSSVRSRIAEYFVGNYTVVSADFYLGRDITYYVV
QTYIPSSMITCLSWLSFWINRNAVPARVALGITTVLTMTTLVGNAGNSLPKLSYIKAIDL
FLGMCYFFVFAALLEYVIVIYYDQPRYRKARELMKEFQDHEHAANKEDSARTNDVAIAID
DEGTSKSRSEQNGRTSTSSSRDHRRPPTSQDINRSLQLDAMRKAGDADCGFLEGKVETEE
PDCMQETLCSFAQSIREKVCVFGFNPYSVDKVARVAFPLTFFSLNLVYWLVYLVFDNITL
EDLMNKET
Download sequence
Identical sequences W4ZAT9
SPU_025266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]