SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_025701 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_025701
Domain Number 1 Region: 247-306
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000229
Family PB1 domain 0.00054
Further Details:      
 
Domain Number 3 Region: 1063-1098
Classification Level Classification E-value
Superfamily UBA-like 0.0000000481
Family UBA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_025701
Sequence length 1109
Sequence
MEENIALEVRFEGETQIYSPAYKTKWQDLLAMLKCSFDLEDIVVTYIDDEEDEIAVDTEE
EYDQAKALASKCNNVLRLRVSRVIILDTLPKESPSLPETTEAVKRKRMHTPPRPEKETPY
PQPGPALPSTPPIPVPPPRPKVPPRLNRTTSLPGHKQPTDVSGYVMKAMEELKQLNISTP
EQSDGPNKEKEVIDQIVKGVLDGLGSGPLEKTRPFSWEPSQMLAGTRTPMCSSPLTAEQG
TKPKNRTPAKLVHEGITCDKCEGVITGFRYKCGHCLDFDLCEECEAQPGSHDPNHVFLKL
KRPAYRVGVKSDGRVAPIFKHPIYADDDTPVWEYKIKKLEEKMARKAARAELKRKYREEK
HRVRVECHSQVSPTKRERIEKMAEKQAEQIMAAASIAATPTTPTTSAADSTTEITPLLAL
LDNVEDSESIIIIKYGAGFVSDGNLPDETHLQPLTKFVKSWIMINNGSVKWNSDTKLKYL
WGNIKILSADSMDIPLLSPGEEGPICVDFEASDKPGHYQSHWRLTQKGEQFGHRVWCNII
VDKAEVLEPRCESKKTVQEELILPKVKEDETVETDSSENTPSSDMAHLQSDQSDSCSPTR
MASRSDVLTAHDVFSFELLSIHDDQEADKEVAGVNSPAATTTPNNTPIVGLTPCISPIPQ
LDEKLLCRRVSEHSDLEIIRREDIPEIIETQDMVRDEPGFEMAQDGVAVAFSFSDEDLDD
VESICSSSDSDMLDDYCVVPLPDCFDPTKPLDKSMILSRTSMSSSMTSSVLAPNAENAPL
VRLPSYEESQAELGGSTTPQASALIIQEDEVPQFSAAAEDITAPSAEQDGGRTEEIIQME
EVPEEEATNVAPSVDAILSTSNPALEITPLIPLVAATPVQTTIPPSSPKPTTPSQETVTM
APMPEITLLASPVPTQFEEAVLINPEGSVMYATRQPEVVRETRTTPVSSAAEGTNLDLIE
TTVQPQETQVQDRERHEEHDDEFHDAQDVPTQQENTQYNNTYNDVQVEADPVDLLGYTAA
RAVEVAGNVVRQAFGTAASSVNALLRPQPIPRPAPYEPPNLSSMDQLIEMGFGDRTKNQQ
LLEKHNDDVSKCVQDLLQAEDNDWTDNRH
Download sequence
Identical sequences W4ZC17
7668.XP_001186499 XP_011661123.1.5271 XP_791508.1.5271 SPU_025701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]