SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_028560 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_028560
Domain Number 1 Region: 25-228
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 2.75e-54
Family Nicotinic receptor ligand binding domain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 230-300
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.66e-28
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_028560
Sequence length 308
Sequence
MANDVEKTLLAAAAATSALRLQNQTAEILNRIFDGYDKRLRPGFGGPPIDVTVSMYVYSM
GPITESKMEYTLDMYFRQQWRDERLQFDSEVGLALNAETLDSFWVPDIYIINEKSAAYHT
VLYKNSLLRIEPTGEMLFSTRLTVTASCNMDLSTFPFDKQRCSLDMESYAYSEDDVKFKW
LENGPVYVDPKISLPQFKFLDSSVRSRIAEYFVGNYTVVSADFYLGRDITYYVVQTYIPS
SMITCLSWLSFWINRNAVPARVALGITTVLTMTTLVGNAGNSLPKLSYIKAIDLFLAPIL
FYQNPLAK
Download sequence
Identical sequences W4ZK41
SPU_028560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]