SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_000721 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_000721
Domain Number 1 Region: 380-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-42
Family MAM domain 0.00034
Further Details:      
 
Domain Number 2 Region: 207-370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-41
Family MAM domain 0.00022
Further Details:      
 
Domain Number 3 Region: 38-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-40
Family MAM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 742-917
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-33
Family MAM domain 0.0032
Further Details:      
 
Domain Number 5 Region: 565-733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-25
Family MAM domain 0.0037
Further Details:      
 
Domain Number 6 Region: 924-1085
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-18
Family MAM domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_000721
Sequence length 1180
Sequence
MVLYCRVCAAACTLSYLLFLLLVSGGHGQADLDPQVILSCNYENETDPFCGFTQDTLDDF
DWTRQAGTTSTENTGPSVDHTYGSTEGYYIYTESSLPQTHGHVARLVSPMMQPSTTPICF
AFYYQMNGEDIGKLRVLLQTANGTDDPTLLKQWSGHQDDKWLKSGITIQPQTEDYQIILE
SEVGESYRGDVAIDDLMILDKVCPLDNLTCDFETSQVCGFTQDTTDDFDFWWHAGSTSSS
STGPRTDNTFKNASGHYMFIETSYRQQGHVARMISPMMAGHGGRPSCMIFYYHMFGRIMG
DLNVHIKNSTSDDIGDPVWSLSGNRGDKWRAAEVVISTPYDYQVVFEAERGESYQGDIAI
DDVNITFTECPGFHHIKNFSSVNCDFEEAEICYYEQNKDDQFDWTWANRGTWWRFTGPSA
DHTLGNELGFFMYIEASWSTPRNSYARLTSPEVGAQRRPSCLEFWYHMYGVDVEELNVYI
MASDGPLPSTPTWTLTGDHGDYWHRATVNINMLNRPFKVVFEGKRGVSRRDDVALDDIKV
YQSRSCPPFTTDFPPATTTPRPWNALQCTFEQDYCNFTQAYDDIFDWVRHKGTVTWRWWF
ETVHKDHTLGTNQGHFMLLQVMEWWNHLTNDNARTMTPLLQGSSNPRCLSFWFILNGRFA
DFFNVYILNHGETLNFDPDLVFYGDHGPKWTQAFLDIPPSTYPFYVVFEGIIGFMWATTE
TAIDDIQLLNQKCMRPVPTTPPISADCNFEDGQGDGMCNYVQVLETKFRWWQRSDIFFWQ
RNVGNTATVNTGPPFDHTFRNSSGYYLLAEASQPQRPGDKARFTSRPLASTGDRICLQFY
YYMTGDDIGSLTVLWSAPHYEEKPIFQTSKMADRWQSAYVDIKDIVDNYKITFEAKVGTG
SQGDIGIDDIRFLRTPCSGFEPESTCGFDADYESCYYRQGDADLLEWIWYDSRGTEPSPL
GNSSDQVGSFLFIKGDTKVPGPTASLFAPRIPTKAMDHCLSYDVTVQNDPAMKLVVAVEY
QNSNWRNLQTVNTTNAAKWTHFDLKLDLSLLTEDTFQIVLITYFGNNKTDGLIALDNITI
SQASCDVVKARTAARENQKRSGGGSKASVALGVILTLVIVGVVIMLVVAWFYIRRSGFGN
TPFAIKYKNRENDNISPVSMPGEPGIANPVYEKPDIDNNA
Download sequence
Identical sequences W4XBH3
SPU_000721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]