SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_000985 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_000985
Domain Number 1 Region: 70-234,282-401
Classification Level Classification E-value
Superfamily L domain-like 8.05e-35
Family Internalin LRR domain 0.03
Further Details:      
 
Domain Number 2 Region: 431-559
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.24e-28
Family Toll/Interleukin receptor TIR domain 0.00093
Further Details:      
 
Weak hits

Sequence:  SPU_000985
Domain Number - Region: 14-75
Classification Level Classification E-value
Superfamily L domain-like 0.0323
Family Ngr ectodomain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_000985
Sequence length 563
Sequence
MDSWTRTLLILVVIFLGGIVQKAFGYLPKVGILNMNNINLSTFNVRYFMGHVEINRLLLT
FSGIKNIHPVNISSMQKENLPLIKELYLDYNILKNIPGYALRGFANLQVLNLQGNRIHSI
NNESFCGLHSLLDLSLFHNRLTSLPRAAFACASDLRKINLSRNKLATMDPQWFDGSLSLC
SLIIYQSTIGRIKIGPWKATNLQTLVLTKNNLDFLNSNTFTGLANLKSLDVSGNVDRLRM
SEDAFTSVGSLEFLVMAHLGNFTMTGSFRNTQNLLHLDISCSLLKIPSIDQFTNTSALRV
LNMTESYLTAEDLFDKHTGTSLFSGLVSLRSLFLRENYLNNLHALPGIFTPLGSLVELDL
TSCRMQHVASGTFANLTTLRLLSLTNNDLTSIPKDAFQVLTLGVLVYLNRWGINYTFYLL
KLAIVGYHEITEDRNPEDYEYQLNLMFHDDNEWVVYLNAIYDVIENSHKTILLLSNQSVD
DTWYMTELRMAVEHMNDTKLEKVILIFLEDIDDDHLPYLVRLLLSRNKPHLSWTEDEEGQ
EVFWAKVQKSMRSNRQMNNVIPI
Download sequence
Identical sequences SPU_000985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]