SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_001417 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_001417
Domain Number 1 Region: 2-34,126-171
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.35e-16
Family Phospholipase D 0.055
Further Details:      
 
Domain Number 2 Region: 239-285
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000034
Family Phospholipase D 0.062
Further Details:      
 
Weak hits

Sequence:  SPU_001417
Domain Number - Region: 188-234
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000131
Family Nuclease 0.095
Further Details:      
 
Domain Number - Region: 334-371
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00377
Family Nuclease 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_001417
Sequence length 377
Sequence
MLWAHHEKGVIIDQRIAFIGGIDICYGRWDDFRHRLVDTGDACYQQEEPVGEDVPDGRAK
QARNQNGSLGHNGYLTGVEKRMHSLGIVEGAKQLWLGKDYYNPIFKDVVQPELPFEETMD
RSSVPRLPWHDIAAVVHGKAALDVARHFIQRWNFTKEQKKKEMSDVPLLIPKSSATVSDV
GLPCTPGASRCRCQILRSSCQWSAGMQHVEDSIHQAYIHAINNSKHYIYIETMDRSSVPR
LPWHDIAAVVHGKAALDVARHFIQRWNFTKEQKKKEMSDVPLLIPKSSATVSDVGLPCTP
GASRCRCQEYSVSPLVTFCDGDDIECKQNCFYMPILRSSCQWSAGMQHVEDSIHQAYIHA
INNSKHYIYIEVSSRRR
Download sequence
Identical sequences W4XDG2
SPU_001417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]