SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_001877 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_001877
Domain Number 1 Region: 73-176,298-418,476-647
Classification Level Classification E-value
Superfamily L domain-like 2.04e-45
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 729-886
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.84e-33
Family Toll/Interleukin receptor TIR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_001877
Sequence length 892
Sequence
MAFKHQLLLLHLVISLAQTLLGVATLVPSKSLHLDTSLQGCDKDLERKKMFCGDRGFISV
PQHLPDDTEGLYLEYNTITSLLGSSFRRYPHITDLDLSHNDIKVIESTALHPLKDLTRFD
ISYNFQLVLPGRGFIRWTRKLSHLNVSNSKLTSIPNDILKWSRKLDTVNLRGNLLTAINI
SSCGKAGNVDLSNNMIENLTKYAFNFVCHSDTLDLQGNPIRSVDPSVIASFQVRELKLGW
RVLTIEELRNIFIGMSRSLIEIFTLTNGSDLSVVPKDLFDALRDCSLRILDLSMNQLRAP
YRRVFSKLTSLRQFHLRGNGIVTIEPDFFEGMDNLRVLDLKSNHIKDINTDNVSWTIDLI
ELHLSGNALTTIRESAFRGLHNLTLLDLRSNELLKIVWATSFLELKSIQTIDLSGCMIRP
FQVMIPSSVTSLFLNYMVIPLNFVNLTTSFKHLQLLEHLEMKESDLMNNNLWNPDVNVSL
FDGLFNLKTLDLSINQLYIHLDVKGMLPPWILRQLSTLQYLNLRTCFFSNIHPQAFIALK
SLRVLILSYNQMHQLPVDLFKPLDQVTSIDLANNFLTDLDGAIFLNNPLLETLLLSNNKL
IRLEQNAFKPLYSSLVFIDLSMNPIDCNCDLSWFLDWLNGPLRLTFLEDDFDDDKTICSS
ASLEPLRGKHLIDFDPREFCSINITLVCLPTLAIICLIFIVALVYHYRWPLRYRLFLVKL
AAVGYEEMRDARDHNDYQYDLNVIFYDEDEEWIREHLRPALAERLPQFQRNVFGDEDLVL
GMHYLESVDYVVSHSYKTVVVLSSAAVLDRWFILKFRTAMDHVSDTLTEFVVVVFLEDIP
DDEMPFLARLYLSDGRPYIHWTEDVRGHEYFFDKLTKSLTINLRTNDRIPNV
Download sequence
Identical sequences W4XER3
SPU_001877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]