SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_002894 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_002894
Domain Number 1 Region: 167-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 37-73
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 12-34
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number 4 Region: 77-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000471
Family LDL receptor-like module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_002894
Sequence length 223
Sequence
MSIQSFFNPKLNIPMSFYCDNVTHCEDRSDELDCAPYNCNTGEFRCDNGRCIAYGLKCDL
VDHCFDKSDEMYCGSGSDNRFTCYNGDEHPLSVQCDGIIDCIGNSAEDESESCENRRLNH
NCADEEVECSNGVCVDTGSRCIYGINPSQYISGCRDVSHLRSCGDFQCPDYSIKCPGSYC
IPLRFRCNDVWDCANGEDELECAGRLLKMFPKPFVHAAMRIER
Download sequence
Identical sequences W4XHM3
SPU_002894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]